DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG33465

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:285 Identity:76/285 - (26%)
Similarity:118/285 - (41%) Gaps:36/285 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNV-NDFYVAR 120
            |.:|..:......:...||...:    |...|.   :|.|:|:...:|||||.|::. :..||. 
  Fly    29 PKTSENINFNHGATETAPWMASI----YKNNQF---ICDGTLVHKLFVLTAASCISKDSQLYVL- 85

  Fly   121 VRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYT 185
              .|.::...|        .::.:......:.|.|:  |..:...||  .|||.||||...|.:.
  Fly    86 --FGMYNQYRD--------ASQFFNNEQYGVAVALQ--HSNFRPNNG--VNDIGLLRLYGEVTHY 136

  Fly   186 LQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSPDECLNRYPTLLVDK 250
            ..||||||.....:.::.|:.  |:..||...|.:..|.|.:...:|...|.|| :|...||...
  Fly   137 AHIRPICIILDHVVKSAPFER--FEGFGWQQQGTEASSQVRQTVYLSQKKPFEC-HRNGQLLPIN 198

  Fly   251 DIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGG---GPSSYGYGPAVYTKTSS 312
            :.|.||...|.:.. ..:|||||.|....|........|:.|||.   .|:|      |||...:
  Fly   199 EGQFCAGNRDRSFC-RSNSGSPLTADFTYGVKNITVQVGLVSYGSELCSPTS------VYTDVVA 256

  Fly   313 YYEWIKKKINDIAEDERKMKYKSVR 337
            :.:||...:.:......::.|:..|
  Fly   257 FKDWIYNTVRNFETKGDQVVYEECR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 72/261 (28%)
Tryp_SPc 62..317 CDD:214473 70/258 (27%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 72/249 (29%)
Tryp_SPc 46..261 CDD:214473 70/246 (28%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463660
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.