DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG10472

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_648017.1 Gene:CG10472 / 38688 FlyBaseID:FBgn0035670 Length:290 Species:Drosophila melanogaster


Alignment Length:313 Identity:87/313 - (27%)
Similarity:135/313 - (43%) Gaps:64/313 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NKLCNINPFAHELVHMVFTCCPMVAGDKLPDSRVCGQSPPSSYIVGGMEAQSNQFPWTV-LLGYE 82
            |.:.|:|         :.|..|.|.|:.||..|          |.||..|:.||||:.| ||.|.
  Fly    23 NSVKNLN---------IETPMPKVHGETLPSGR----------ITGGQIAEPNQFPYQVGLLLYI 68

  Fly    83 AYTAKQRPSPMCAGSLIASRYVLTAAHCLNV----NDFYVARVRLGEHDTENDPDYTWLPNGAKI 143
            ...|     ..|.|::|:.|:::|||||.:.    .|.|     ||.||..|..:     .|.:|
  Fly    69 TGGA-----AWCGGTIISDRWIITAAHCTDSLTTGVDVY-----LGAHDRTNAKE-----EGQQI 118

  Fly   144 WAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFP 208
                 :.::....:.||.:....  ..|||:|::|...:::...|:|    ..:.:.:.|:..:.
  Fly   119 -----IFVETKNVIVHEDWIAET--ITNDISLIKLPVPIEFNKYIQP----AKLPVKSDSYSTYG 172

  Fly   209 FQIA---GWG---DSGLQQKSTVLRQGTISGMSPDECLNRYPTLLVDKDIQICAMGWDGTDTGLG 267
            .:.|   |||   ||. ...:.:|:..|:..|:...|...|..|:...:|.|...|  |..|..|
  Fly   173 GENAIASGWGKISDSA-TGATDILQYATVPIMNNSGCSPWYFGLVAASNICIKTTG--GISTCNG 234

  Fly   268 DSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYGPAVYTKTSSYYEWIKKK 320
            |||.||:...|...     |.|.||:|.........|.|:|:.:.|.:||::|
  Fly   235 DSGGPLVLDDGSNT-----LIGATSFGIALGCEVGWPGVFTRITYYLDWIEEK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 76/268 (28%)
Tryp_SPc 62..317 CDD:214473 74/265 (28%)
CG10472NP_648017.1 Tryp_SPc 46..279 CDD:214473 75/276 (27%)
Tryp_SPc 47..282 CDD:238113 76/268 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436288
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.