DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG6592

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:267 Identity:87/267 - (32%)
Similarity:123/267 - (46%) Gaps:43/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 IVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPM--CAGSLIASRYVLTAAHCLNVNDFYVARVRLG 124
            |.||.....:.||      |:.....|||..:  |.||||:.::|:|||||:::..  .|.|.||
  Fly   123 IFGGDVGNPHCFP------YQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAK--RALVFLG 179

  Fly   125 EHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQ---YYTRNGRHY-NDIALLRLKSRVKYT 185
            .::.:|                |.....|.|.||.|.   |.|.|.:.. :|||::||...|.:.
  Fly   180 ANEIKN----------------AKEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFN 228

  Fly   186 LQIRPICIWPGIELSTSSFKNFPFQIAGWG--DSGLQQKSTVLRQGTISGMSPDECLNRYPTLLV 248
            .:|.||.: |.......||||.....:|||  .:|:...|.|||...:..:....|.:.:|  |.
  Fly   229 ERIHPIQL-PKRHYEYRSFKNKLAIASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFP--LS 290

  Fly   249 DKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYG---PAVYTKT 310
            .:...||..|.:...|..||||.||:  :.|...:...|.||||:|   |.||..   ||.:||.
  Fly   291 YRGTNICTSGRNARSTCNGDSGGPLV--LQRRHSKKRVLVGITSFG---SIYGCDRGYPAAFTKV 350

  Fly   311 SSYYEWI 317
            :||.:||
  Fly   351 ASYLDWI 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 87/267 (33%)
Tryp_SPc 62..317 CDD:214473 85/265 (32%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 85/265 (32%)
Tryp_SPc 123..359 CDD:238113 87/267 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436420
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.