DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and yip7

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:280 Identity:80/280 - (28%)
Similarity:125/280 - (44%) Gaps:48/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PDSRVCGQSPPS--SYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHC 110
            |..||   |.||  ..|..|.:|.:.|||:.|.|.:.:...    |..|.||:|.:.:|||||||
  Fly    27 PRDRV---STPSITGRITNGKDAVAGQFPYQVGLSFSSSAG----SWWCGGSIIGNEWVLTAAHC 84

  Fly   111 ----LNVNDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYN 171
                .:|..:|.|.||       ..|::|.:.:.:|.             ..||.|.....|  |
  Fly    85 TDGAASVTIYYGATVR-------TSPEFTQVVSSSKF-------------RQHESYLALTIR--N 127

  Fly   172 DIALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQK--STVLRQGTISGM 234
            ||:|::..| |.::..:..|.: |.:..|.|:::......:|||.:..|..  |..|:...::.:
  Fly   128 DISLIQTSS-VSFSATVNKISL-PAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTII 190

  Fly   235 SPDECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSS 299
            |..:|...:.:|:|...: :|....:...|..||||.|| |..|       .|.|.||:|.....
  Fly   191 SNSKCQETFGSLIVTSRV-LCVDTTNKASTCQGDSGGPL-ALDG-------VLIGATSFGSADGC 246

  Fly   300 YGYGPAVYTKTSSYYEWIKK 319
            ....||.:|:.:.|.:|||:
  Fly   247 ESGAPAAFTRITYYRDWIKE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 74/264 (28%)
Tryp_SPc 62..317 CDD:214473 71/260 (27%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 71/261 (27%)
Tryp_SPc 40..267 CDD:238113 74/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.