DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG10477

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:266 Identity:75/266 - (28%)
Similarity:116/266 - (43%) Gaps:45/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 IVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCL----NVNDFYVARVR 122
            |..|.:|.:||||:.|.|.:::...    |..|.||:||:.:|||||||.    :|..:|.:.||
  Fly    40 ITNGNKAAANQFPYQVGLSFKSSAG----SWWCGGSIIANTWVLTAAHCTKGASSVTIYYGSTVR 100

  Fly   123 LGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQ 187
                            ..||:    ...:.....|.|..|.....|  |||:|::..| |.:|:.
  Fly   101 ----------------TSAKL----KKKVSSSKFVQHAGYNAATLR--NDISLIKTPS-VTFTVS 142

  Fly   188 IRPICIWPGIELSTSSFKNFPFQIAGWG---DSGLQQKSTVLRQGTISGMSPDECLNRYPTLLVD 249
            |..|.: |.|..|.|::.......:|||   ||.: ..:|.|:......::...|...:.:.:|.
  Fly   143 INKIAL-PAIASSYSTYAGQTAVASGWGRTSDSSI-AVATNLQYAQFQVITNAVCQKTFGSSVVT 205

  Fly   250 KDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYGPAVYTKTSSYY 314
            ..: ||....:...|..||||.||..:        ..|.|:||:..........||.:|:.:||.
  Fly   206 SGV-ICVESINKKSTCQGDSGGPLALN--------NRLIGVTSFVSSKGCEKNAPAGFTRVTSYL 261

  Fly   315 EWIKKK 320
            :|||.:
  Fly   262 DWIKNQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 75/264 (28%)
Tryp_SPc 62..317 CDD:214473 72/261 (28%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 72/261 (28%)
Tryp_SPc 40..267 CDD:238113 75/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436189
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.