DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG10764

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:286 Identity:90/286 - (31%)
Similarity:126/286 - (44%) Gaps:62/286 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CGQSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCL-NVNDF 116
            ||.|.... |.||.:|......|...:...:       ...|.|::|..|:||:||||| ...|.
  Fly    30 CGISTRPK-ISGGDDAAEPNSIWMAAIFNSS-------DFQCGGTIIHMRFVLSAAHCLVRGYDL 86

  Fly   117 YVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSR 181
            |   ||||..:. |:|            |..|..|:|.:   |..:.....|  |||.||:|...
  Fly    87 Y---VRLGARNI-NEP------------AAVHTVINVFV---HHDFIASEYR--NDIGLLQLSES 130

  Fly   182 VKYTLQIRPICIW--PGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGM---------S 235
            :.||::::||||:  |.::.|....|.  |:..|||:          |.|.:|.|         .
  Fly   131 IVYTVRVQPICIFLDPALKGSVEKLKT--FRALGWGN----------RNGKLSIMLQTIYLLHLK 183

  Fly   236 PDECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYL-AGITSYGGGPSS 299
            .:||..:....|..:  |||| |....||..||||.||..::...:::.|.: .||.|: |.|..
  Fly   184 RNECKRKLNFNLNSR--QICA-GTKNGDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSF-GDPEC 244

  Fly   300 YGYGPAVYTKTSSYYEWIKKKI--ND 323
            .|.|  |||..:||.:||...|  ||
  Fly   245 RGVG--VYTDVTSYVDWISSTIARND 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 84/270 (31%)
Tryp_SPc 62..317 CDD:214473 82/267 (31%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 82/269 (30%)
Tryp_SPc 38..263 CDD:238113 84/270 (31%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463517
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.