DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and Jon44E

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster


Alignment Length:312 Identity:77/312 - (24%)
Similarity:116/312 - (37%) Gaps:80/312 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VFTCCPMVAGDKLPDSRVCGQSPPSSY---------IVGGMEAQSNQFPWTVLLGYE--AYTAKQ 88
            ||..|..||...:..|......|....         |..|..|...:.|:.|.|.:.  .|    
  Fly     5 VFLACLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGY---- 65

  Fly    89 RPSPMCAGSLIASRYVLTAAHCLN----VNDFYVARVRLGEHDTENDPDYT-WLPNGAKIWAPAH 148
                .|.||:|...:|||||||.|    |..::.|..|   |:.:    || |:.....|..|..
  Fly    66 ----WCGGSIIDHTWVLTAAHCTNSANHVLIYFGASFR---HEAQ----YTHWVSRSDMIQHPDW 119

  Fly   149 VDI---DVDL-RVPHEQYYTRNGR----HYNDIALLRLKSRVKYTLQIRPICIWPGIELSTSSFK 205
            .|.   |:.| |:||..:::...:    .|||          :|                 :|:.
  Fly   120 NDFLNNDIALIRIPHVDFWSLVNKVELPSYND----------RY-----------------NSYS 157

  Fly   206 NFPFQIAGWG----DSGLQQKSTVLRQGTISGMSPDECLNRYPTLLVDKDIQICAMGWDGTDTGL 266
            .:....:|||    :||:   |..|....:..:..::|.|.|.:..: .|..||.....|..:..
  Fly   158 GWWAVASGWGLTDNNSGM---SNYLNCVDVQIIDNNDCRNYYGSNYI-TDNTICINTDGGKSSCS 218

  Fly   267 GDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYGPAVYTKTSSYYEWIK 318
            ||||.||:.....      .:.||.|:|.|.......||.:|:.:.|.:||:
  Fly   219 GDSGGPLVLHDNN------RIVGIVSFGSGEGCTAGRPAGFTRVTGYLDWIR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 70/276 (25%)
Tryp_SPc 62..317 CDD:214473 68/273 (25%)
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 68/274 (25%)
Tryp_SPc 41..266 CDD:238113 70/276 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435661
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.