DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and scaf

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:287 Identity:72/287 - (25%)
Similarity:118/287 - (41%) Gaps:72/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLN---VNDFYVARVRLG 124
            |..::|...:.||..::..|:     ..:.:|.|::|..::||::|.|:|   |.|.   ||:.|
  Fly   424 VKDLDANFAEIPWQAMILRES-----SKTLICGGAIIGDQFVLSSASCVNGLPVTDI---RVKAG 480

  Fly   125 EHD--TENDPDYTWLP---NGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKY 184
            |.:  :.|:|    ||   .|.|       .:||     |..|......|  |:|::||:.|:::
  Fly   481 EWELGSTNEP----LPFQLTGVK-------TVDV-----HPDYDPSTNSH--DLAIIRLERRLEF 527

  Fly   185 TLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSP------DECLNRY 243
            ...|:||||  ..|....|.:.|   .:|||    :|..::..:|.:..::.      .||    
  Fly   528 ASHIQPICI--SDEDPKDSEQCF---TSGWG----KQALSIHEEGALMHVTDTLPQARSEC---- 579

  Fly   244 PTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYGPAV-Y 307
               ..|......|..:|....   |.||.|..    |:.....|.||.:   |.:|.|.|..| :
  Fly   580 ---SADSSSVCSATKFDSCQF---DVGSALAC----GSGSSVRLKGIFA---GENSCGEGQTVRF 631

  Fly   308 TKTSSYYEWIKKKINDIAEDERKMKYK 334
            .|..  .:||.   ...||:.:.:..|
  Fly   632 AKPD--IKWIN---TAFAENNKPLLLK 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 69/271 (25%)
Tryp_SPc 62..317 CDD:214473 67/268 (25%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 58/236 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435490
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.