DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG17572

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:295 Identity:85/295 - (28%)
Similarity:138/295 - (46%) Gaps:39/295 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FTCCPMVAGDKLPDSRVCGQSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIA 100
            :.|||   ...|..::|||:|....:...|:    ..:|:...:|::.........| |||::||
  Fly   110 YVCCP---SSPLEKNQVCGKSLVQGHFYKGL----GSYPFVARIGFKHVNTGAFAYP-CAGAVIA 166

  Fly   101 SRYVLTAAHC--LNVNDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYY 163
            .|.:||||||  ...:...::.||:||:||.:|||..    .....||..|:..:...:.|..| 
  Fly   167 RRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCA----NTGFCAPRSVNHAISHVIVHPDY- 226

  Fly   164 TRNGRHYNDIALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQ 228
             :.|::::|||||.||:.:.|::..:|||:.   :...:........|||||    :..::.:||
  Fly   227 -KQGQYHHDIALLVLKTPLNYSVATQPICLQ---KTRANLVVGKRATIAGWG----KMSTSSVRQ 283

  Fly   229 GTISGM-----SPDECLNRYPT---LLVDKDIQ---ICAMGWDGTDTGLGDSGSPLMASVGRGAD 282
            ..:|.:     |.|.||..|.:   |.....|:   :|| |.:|.|...|..|:||...    .:
  Fly   284 PEMSHLDVPLTSWDLCLRNYGSTGALESPNSIEGQWMCA-GGEGKDVCQGFGGAPLFIQ----EN 343

  Fly   283 QFYYLAGITSYGGGPSSYGYGPAVYTKTSSYYEWI 317
            ..:...||.|:|.........|:|||..:.:.|||
  Fly   344 GIFSQIGIMSFGSDNCGGLRIPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 77/269 (29%)
Tryp_SPc 62..317 CDD:214473 75/267 (28%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 76/260 (29%)
Tryp_SPc 138..378 CDD:214473 74/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.