DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG9377

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:351 Identity:85/351 - (24%)
Similarity:139/351 - (39%) Gaps:97/351 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TNDQKSQYRNKLCNINPFAHELVHMVFTCCPMVAGDKLPDSRV--------CGQSPPSSYIVGGM 66
            |.|:...|..|.|||                   .||||..::        ||......|.:..:
  Fly    55 TLDENCHYMEKCCNI-------------------PDKLPTPKIPEEMMSCPCGGRHDLWYYLRPL 100

  Fly    67 -----EAQSNQFPWTV-LLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDFYVARVRLGE 125
                 ||:..:|||.| :.|.:.|        :|:|:||....|:|.|||:..::....|:..||
  Fly   101 GYKQQEAKFGEFPWLVAVYGSDTY--------LCSGALITPLAVITTAHCVQNSEMEKVRLLAGE 157

  Fly   126 HDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQ----------YYTRNGRHYNDIALLRLKS 180
            .|                   |.|:::..   ||:|          .||:....:| ||:|.:..
  Fly   158 WD-------------------AAVELEPQ---PHQQRSVVETLVHPNYTQMPLAHN-IAILLVDK 199

  Fly   181 RVKYTL--QIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSPDECLNRY 243
            ...:.|  .::|||:.|    ....:......::||..|...:.:.:.::.|:..:.||:|..:.
  Fly   200 EKPFQLAPNVQPICLPP----PRIMYNYSQCYVSGWQRSDFGRAAILPKRWTLYVLPPDQCRTKL 260

  Fly   244 PTLLVDK-----DIQICAMGWDGTDTGLGD---SGSPLMASVGRGADQFYYLAGI---TSYGGGP 297
            ...|:.:     |..:|| |.|..|...||   :..|||..:. |.|..::|||:   |:...||
  Fly   261 RLSLLGRRHAHNDSLLCA-GGDKGDFVCGDVDMTAVPLMCPLS-GHDDRFHLAGLLTRTARCDGP 323

  Fly   298 SSYGYGPAVYTKTSSYYEWIKKKIND 323
            ...|    :||....|.:||..|:.:
  Fly   324 QLLG----IYTNVKLYRQWIDLKLRE 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 70/286 (24%)
Tryp_SPc 62..317 CDD:214473 68/283 (24%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 69/275 (25%)
Tryp_SPc 105..339 CDD:214473 68/274 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435457
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.