DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:290 Identity:75/290 - (25%)
Similarity:109/290 - (37%) Gaps:76/290 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LP-DSRVCGQSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHC 110
            || |:::.|:      ||.|..|...:.|:||.||:..     .....|.||:||..:|||||||
  Fly    27 LPKDTKINGR------IVNGYPAYEGKAPYTVGLGFSG-----NGGWWCGGSIIAHDWVLTAAHC 80

  Fly   111 LN----VNDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYN 171
            .|    |..:|.|               ||..|..........|.     :.:..:..:||   |
  Fly    81 TNGASQVTIYYGA---------------TWRTNAQFTHTVGSGDF-----IQNHNWPNQNG---N 122

  Fly   172 DIALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSP 236
            ||||:| ...|.:...:..:.: |......:.:.|:.....|||             .|.:|..|
  Fly   123 DIALIR-TPHVDFWHMVNKVEL-PSFNDRYNMYDNYWAVACGWG-------------LTTAGSQP 172

  Fly   237 D-------------ECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLA 288
            |             ||...|.|   ..|..:|.....|..|..||||.||:...|.      .|.
  Fly   173 DWMECVDLQIISNSECSRTYGT---QPDGILCVSTSGGKSTCSGDSGGPLVLHDGG------RLV 228

  Fly   289 GITSYGGGPSSYGYGPAVYTKTSSYYEWIK 318
            |:||:..|.......|:.:|:.::..:||:
  Fly   229 GVTSWVSGNGCTAGLPSGFTRVTNQLDWIR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 71/274 (26%)
Tryp_SPc 62..317 CDD:214473 69/271 (25%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 69/278 (25%)
Tryp_SPc 37..260 CDD:238113 71/274 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435925
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.