DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and psh

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_573297.1 Gene:psh / 32832 FlyBaseID:FBgn0030926 Length:394 Species:Drosophila melanogaster


Alignment Length:275 Identity:88/275 - (32%)
Similarity:127/275 - (46%) Gaps:49/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 YIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDFYVARVRLGE 125
            :||||.......:|....:||..:....|    |.|||||||:|||||||:|.:....|.||||.
  Fly   143 HIVGGYPVDPGVYPHMAAIGYITFGTDFR----CGGSLIASRFVLTAAHCVNTDANTPAFVRLGA 203

  Fly   126 HDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRP 190
            .:.|| ||:            ::.||.:.....|.||.   |..|||||:|.|:..|..|..|||
  Fly   204 VNIEN-PDH------------SYQDIVIRSVKIHPQYV---GNKYNDIAILELERDVVETDNIRP 252

  Fly   191 ICIWPGIELSTSSFKNFPFQIAGWG--DSGLQQKSTVLRQGTISGMSPDECLNRY---------- 243
            .|:...   :|....|..|.:||||  :...:.:|.:|.:..:..:..|:|...|          
  Fly   253 ACLHTD---ATDPPSNSKFFVAGWGVLNVTTRARSKILLRAGLELVPLDQCNISYAEQPGSIRLL 314

  Fly   244 -----PTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYG 303
                 .:||...|.::.|      |...||||.||:..: ...|..|.:.|:.|.|.|.::  ..
  Fly   315 KQGVIDSLLCAIDQKLIA------DACKGDSGGPLIHEL-NVEDGMYTIMGVISSGFGCAT--VT 370

  Fly   304 PAVYTKTSSYYEWIK 318
            |.:||:.|||.::|:
  Fly   371 PGLYTRVSSYLDFIE 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 88/274 (32%)
Tryp_SPc 62..317 CDD:214473 87/271 (32%)
pshNP_573297.1 CLIP 30..79 CDD:197829
Tryp_SPc 143..384 CDD:214473 87/272 (32%)
Tryp_SPc 144..387 CDD:238113 88/274 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437420
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.