DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG31220

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:308 Identity:119/308 - (38%)
Similarity:171/308 - (55%) Gaps:17/308 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RNKLCNINPFAHELVHMVFTCCPMVAGDKLPDSRVCGQSPPSSYIVGGMEAQSNQFPWTVLLGY- 81
            :.::|.::....:....::.|||..| :.||....||:...::.::||.|...|::||..:|.| 
  Fly    61 QTRMCGVSVRDRKRYKRIYICCPKPA-NTLPSYPDCGKPQTTNRVIGGTEPNLNEYPWLAMLLYR 124

  Fly    82 --EAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDFYVARVRLGEHDTENDPDYTWLPNGAKI- 143
              .|:...:...|.|.||||.:|||||||||:......:.|||||||.|.::||  .:..||:| 
  Fly   125 NRSAFNPDRELVPSCGGSLINTRYVLTAAHCVTDTVLQIQRVRLGEHTTSHNPD--CISRGARIV 187

  Fly   144 WAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPICI--WPGIELSTSSFKN 206
            .||.|:||||:....|..|...|....|||||:|||..|:||:...|||:  :|      .|...
  Fly   188 CAPTHLDIDVESITSHNDYDPANYTFRNDIALVRLKEPVRYTMAYYPICVLDYP------RSLMK 246

  Fly   207 FPFQIAGWGDSGL-QQKSTVLRQGTISGMSPDECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSG 270
            |...:||||.:|: ...|.||:...:....|:||..:|.........||||.|.|...|..||||
  Fly   247 FKMYVAGWGKTGMFDTGSKVLKHAAVKVRKPEECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSG 311

  Fly   271 SPLMASVGRGADQFYYLAGITSYGGGPSSYGYGPAVYTKTSSYYEWIK 318
            ||||.:.||..:...:|||||||||...:.|: |:|:|:|:.:|:||:
  Fly   312 SPLMGTSGRSYETITFLAGITSYGGPCGTIGW-PSVFTRTAKFYKWIR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 110/264 (42%)
Tryp_SPc 62..317 CDD:214473 108/261 (41%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 108/262 (41%)
Tryp_SPc 104..360 CDD:238113 110/264 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463194
Domainoid 1 1.000 130 1.000 Domainoid score I5140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 1 1.010 - - D85090at50557
OrthoFinder 1 1.000 - - FOG0003849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.