DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG31205

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:287 Identity:70/287 - (24%)
Similarity:110/287 - (38%) Gaps:67/287 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CGQSPPSSYIVGGMEAQSNQFPWTV-LLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDF 116
            ||......|....:.|:..:.||.| ::|   .|.....:.:|.|.||.||.|:|||||::.::.
  Fly    29 CGIFNEKQYNSDNIIAEPTEHPWVVRIVG---VTKDGSNTLLCTGILIDSRRVVTAAHCVSKDES 90

  Fly   117 -YVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKS 180
             .:..|..|:.|:.|                  ::: |.....|..|..|  :..||:|::.|..
  Fly    91 ESIYGVVFGDSDSSN------------------INL-VSAVTVHPDYSPR--KFENDLAIIELTK 134

  Fly   181 RVKYTLQIRPICI------WPGIELSTSSFKNFPFQIAGW-GDSGLQQKSTVLR-----QGTISG 233
            .|.::..::|||:      .||.|.|.|.     ..:||. |.|..::.|...|     :.|.:.
  Fly   135 EVVFSDLVQPICLPSVSEMVPGSETSNSK-----LIVAGLEGPSFDRRHSATQRLDKRIKMTYTK 194

  Fly   234 MSPDECLN---RYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASV---GRGADQFYYLAGITS 292
            :...||..   |:|..|      ||.          ....|||..|.   ..|..:.::|.||..
  Fly   195 IDSKECHEKQARFPEEL------ICG----------HTERSPLSGSALTEASGTPRQFHLLGIAV 243

  Fly   293 YGGGPSSYGYGPAVYTKTSSYYEWIKK 319
            .|...|...:  ..|.....:.:||.|
  Fly   244 AGFFSSDLDH--QGYLNIRPHLDWISK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 67/278 (24%)
Tryp_SPc 62..317 CDD:214473 64/274 (23%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 39/152 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.