DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and sphinx1

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:280 Identity:58/280 - (20%)
Similarity:106/280 - (37%) Gaps:74/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 SSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVN--DFYVARV 121
            |..|.||..|::  |....|:|...:.::.......||::|:::::||....|..:  :.::|..
  Fly    23 SPRIAGGYRAKT--FTIIYLVGIVYFKSQTSSLNYGAGTIISNQWILTVKTVLKYSYIEVHLASR 85

  Fly   122 RLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGR-HY-ND--IALLRLKSRV 182
            |                        ::...|: :|:     |..|.| || ||  |||::...: 
  Fly    86 R------------------------SYRGFDI-IRI-----YKENFRFHYDNDHVIALVKCPYQ- 119

  Fly   183 KYTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQK-STVLRQGTISGMSPDECLNRYPTL 246
            |:..::..:.: |..:.....:......:.|:|......| ...:|...:..|:..||...|..|
  Fly   120 KFDRRMDRVRV-PAYDTRFERYVGNMTMVCGYGTEKRHAKLPEWMRCIEVEVMNNTECAKYYTPL 183

  Fly   247 LVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPS------------S 299
               |..::|..|........||.|         ||        :.:.|..|:            |
  Fly   184 ---KWYEMCTSGEGFKGVCEGDIG---------GA--------VVTMGPNPTFIGIIWLMPENCS 228

  Fly   300 YGYGPAVYTKTSSYYEWIKK 319
            .|| |:|:.:.|.:.:|||:
  Fly   229 IGY-PSVHIRVSDHIKWIKR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 57/277 (21%)
Tryp_SPc 62..317 CDD:214473 54/273 (20%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 54/274 (20%)
Tryp_SPc 26..248 CDD:304450 57/277 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436387
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.