DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG11664

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:261 Identity:66/261 - (25%)
Similarity:98/261 - (37%) Gaps:66/261 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 PSPMCAGSLIASRYVLTAAHCLNVNDF-YVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDV 153
            |..:.||||.::|||||.|||...|.. ....||.|         |.|:     .|......:..
  Fly    43 PQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAG---------YRWI-----AWEFRGKQVAG 93

  Fly   154 DLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPI--CIWPGIELSTSSFKNFPFQIAGWGD 216
            .||.|.....|..    ||||:||:|:.:.::..|..|  |..|   |:..:....|.::|||  
  Fly    94 LLRHPKFSPLTLR----NDIAVLRVKAAISHSHMINYIGLCSRP---LTPLNMFAPPQELAGW-- 149

  Fly   217 SGLQQKSTVLRQGTISGMSPDECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGA 281
             .|...:..|:..::.......|...:|.:   ....|||....|.....||||.||::      
  Fly   150 -NLMHIAQPLKSMSVQVEPEKNCRQWFPQI---SGGVICASATMGEGLCYGDSGDPLIS------ 204

  Fly   282 DQFYYLAGITSYGG------------GPSSYGYGPAVYTKTSSYYEWIKKKINDIAEDERKMKYK 334
                        ||            |...|   ||::|....:..:|.:.:..:   :|:|..|
  Fly   205 ------------GGEVCGLAIAFRKCGDKRY---PALFTDVHYHRAFIAQAVLTL---DREMLSK 251

  Fly   335 S 335
            |
  Fly   252 S 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 62/244 (25%)
Tryp_SPc 62..317 CDD:214473 61/241 (25%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 62/243 (26%)
Tryp_SPc 38..237 CDD:214473 61/241 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.