DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG18420

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:297 Identity:94/297 - (31%)
Similarity:136/297 - (45%) Gaps:54/297 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 MVFTCCPMVAGDKLPDSRVCGQSPP---SSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCA 95
            ::.|..|::...:..||. ||...|   ...||.|..|..|..||...|    :|:..:  .:|.
  Fly    13 LLLTVFPLLGSTQFLDSE-CGTRSPLKLGPRIVNGKVAVRNSSPWMAFL----HTSSNQ--FICG 70

  Fly    96 GSLIASRYVLTAAHCLNVNDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHE 160
            |:||:.|.|||||||...|...|  |||||::.:           .|.:...|   .|:....| 
  Fly    71 GTLISRRLVLTAAHCFIPNTTIV--VRLGEYNRK-----------LKGYREEH---QVNRTFQH- 118

  Fly   161 QYYTRNGRHYNDIALLRLKSRVKYTLQIRPICI-WPGIELSTSSFKNFPFQI-----AGWGDSGL 219
            ::|..| .|.||||||||.|.|.|...|||||| |      .:|:|:....|     .|||.:..
  Fly   119 RFYDPN-THANDIALLRLVSNVVYKANIRPICIMW------DASWKHHIDSIKVLTGTGWGRTES 176

  Fly   220 QQKSTVLRQGTISGMSPDECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVG-RGADQ 283
            ...|:.||...||......|  .:.::|.:   |.||..|: ::..:||:|.|:.|.|. |.|.:
  Fly   177 MHDSSELRTLDISRQPSKMC--AFGSVLSN---QFCAGNWN-SNLCIGDTGGPVGAMVRYRNAFR 235

  Fly   284 FYYLA-GITSYGGGPSSYGYGPAVYTKTSSYYEWIKK 319
            |..:. .||      :.....|:|:|...|:.|:|::
  Fly   236 FVQVGIAIT------NKRCQRPSVFTDVMSHIEFIRR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 87/266 (33%)
Tryp_SPc 62..317 CDD:214473 86/262 (33%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 86/263 (33%)
Tryp_SPc 43..267 CDD:238113 87/266 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463616
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.