DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and F9

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_113728.1 Gene:F9 / 24946 RGDID:2589 Length:462 Species:Rattus norvegicus


Alignment Length:266 Identity:80/266 - (30%)
Similarity:119/266 - (44%) Gaps:42/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 IVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDFYVARVRLGEH 126
            :|||..|:..|.||.|:|..|.       ...|.|::|..::::||||||...|  ...|..|||
  Rat   228 VVGGENAKPGQIPWQVILNGEI-------EAFCGGAIINEKWIVTAAHCLKPGD--KIEVVAGEH 283

  Fly   127 DTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPI 191
            :.:...|.....|             |...:||.||.....::.:|||||.|...:.....:.||
  Rat   284 NIDEKEDTEQRRN-------------VIRTIPHHQYNATINKYSHDIALLELDKPLILNSYVTPI 335

  Fly   192 CIWPGIELSTSSFKNF-PFQIAGWG---DSGLQQKSTVLRQGTISGMSPDECLNRYPTLLVDKDI 252
            |:  ..:..|:.|..| ...::|||   :.|.|  :::|:...:..:....||......:.:.  
  Rat   336 CV--ANKEYTNIFLKFGSGYVSGWGKVFNKGRQ--ASILQYLRVPLVDRATCLRSTKFSIYNN-- 394

  Fly   253 QICAMGW--DGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYG-YGPAVYTKTSSYY 314
            ..|| |:  .|.|:..||||.|.:..| .|..   :|.||.|:|...:..| ||  :|||.|.|.
  Rat   395 MFCA-GYREGGKDSCEGDSGGPHVTEV-EGTS---FLTGIISWGEECAMKGKYG--IYTKVSRYV 452

  Fly   315 EWIKKK 320
            .|||:|
  Rat   453 NWIKEK 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 79/264 (30%)
Tryp_SPc 62..317 CDD:214473 76/261 (29%)
F9NP_113728.1 GLA 21..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 127..163 CDD:291342
Tryp_SPc 227..455 CDD:214473 76/261 (29%)
Tryp_SPc 228..458 CDD:238113 79/264 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.