DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG30286

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:272 Identity:78/272 - (28%)
Similarity:119/272 - (43%) Gaps:29/272 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PDSRVCGQSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLN 112
            ||   ||...|.:......:|..::.||.      ||..|. ...:|.|:|:..|::||||||:.
  Fly    24 PD---CGYMSPEALQNEEHQAHISESPWM------AYLHKS-GELVCGGTLVNHRFILTAAHCIR 78

  Fly   113 VNDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLR 177
            .::...  |||||.::....|.    ||:....|:. |.::|:...|..|...|..|  ||.|||
  Fly    79 EDENLT--VRLGEFNSLTSIDC----NGSDCLPPSE-DFEIDVAFRHGGYSRTNRIH--DIGLLR 134

  Fly   178 LKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSPDECLNR 242
            |...|:|.:.|:|||:.....|.....:.......|||.|..:..:.:|:...::.::...|...
  Fly   135 LAKSVEYKVHIKPICLITNTTLQPKIERLHRLVATGWGRSPSEAANHILKSIRVTRVNWGVCSKT 199

  Fly   243 YPTLLVD--KDIQICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYGPA 305
            |   .||  :| |||.....|.... ||||.|:..::.......:...||.|||....   ..|:
  Fly   200 Y---WVDRRRD-QICVSHESGVSCS-GDSGGPMGQAIRLDGRVLFVQVGIVSYGNAEC---LSPS 256

  Fly   306 VYTKTSSYYEWI 317
            |:|....:.:||
  Fly   257 VFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 73/258 (28%)
Tryp_SPc 62..317 CDD:214473 71/256 (28%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 73/254 (29%)
Tryp_SPc 39..268 CDD:214473 71/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463572
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.