DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG30187

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:287 Identity:88/287 - (30%)
Similarity:122/287 - (42%) Gaps:49/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RVCGQSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVND 115
            ::||.: .:..|.||..|......|..       ....|...:|.|:||..|:|||||||:...|
  Fly    26 QICGIN-IALKITGGHNAAFQNSVWMA-------AVHNRTHFICGGTLIHKRFVLTAAHCIVDQD 82

  Fly   116 FYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKS 180
              |..|.||.::..:..|..                ||...|.|..:..| ..:.|||.||:|.|
  Fly    83 --VQSVSLGAYNKSDPADRK----------------DVITAVVHSSFDVR-ASYENDIGLLKLSS 128

  Fly   181 RVKYTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSPDEC---LNR 242
            .|.:...||||||.....::........|:..|||.....:.|.:|:...::.:..:||   |:.
  Fly   129 DVIFNALIRPICIVLNKSMANHMRNMRTFKAFGWGTLRGNKTSDILQTIILNHLDREECYMELSV 193

  Fly   243 YPTLLVDKDIQICAMGWDGTDTGLGDSGSPL-----MASVGRGADQFYYLAGITSYGGGPSSYGY 302
            ||:     :.|||| |....||..||||.||     :..:|....||    ||.|.|.....   
  Fly   194 YPS-----EKQICA-GVPSGDTCGGDSGGPLTNDVFIQGIGNREVQF----GIISVGKTSCD--- 245

  Fly   303 GPAVYTKTSSYYEWIKKKINDIA-EDE 328
            |..|||...|:.:|||..|..:: |||
  Fly   246 GQGVYTDLMSFADWIKMTIERLSIEDE 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 82/265 (31%)
Tryp_SPc 62..317 CDD:214473 79/262 (30%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 79/263 (30%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.