DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG30091

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:307 Identity:87/307 - (28%)
Similarity:128/307 - (41%) Gaps:71/307 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CG---QSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVN 114
            ||   |..|.  ||||::|...:.||..|:       |.....:|.||:|.:::|||||||:..:
  Fly    27 CGVPMQLIPK--IVGGVDAGELKNPWMALI-------KTNDEFICGGSVITNKFVLTAAHCMCTD 82

  Fly   115 DFYVAR-------------VRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRN 166
            :..:.:             :..|||   |.|               |...:|:....|:.:..:|
  Fly    83 EECIVKYTQLTVTLGVYHLLATGEH---NHP---------------HEIYNVERVYIHDSFAIQN 129

  Fly   167 GRHYNDIALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTI 231
            .|  ||||||||:..:.|..||:|:||....:|...:.....|...|||.:|..:.|..|:...|
  Fly   130 YR--NDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQMVKI 192

  Fly   232 SGMSPDEC------LNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPL---MASVG-RGADQFYY 286
            ..:....|      ...||        ..||....|.||...|||.||   |...| :.|.|.  
  Fly   193 YRIDRKMCEAAFWYTFDYP--------MFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQL-- 247

  Fly   287 LAGITSYGGGPSSYGYGPAVYTKTSSYYEWIKKKINDIAEDERKMKY 333
              ||.| .|.....|:|  :||....:.::|::.:.| |:.|..:.|
  Fly   248 --GIVS-TGTEDCRGFG--MYTDVMGHIDFIERIVLD-ADIEVVLPY 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 79/280 (28%)
Tryp_SPc 62..317 CDD:214473 78/277 (28%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 78/280 (28%)
Tryp_SPc 37..276 CDD:238113 79/280 (28%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463561
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.