DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG30090

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:265 Identity:94/265 - (35%)
Similarity:127/265 - (47%) Gaps:40/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 IVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDFYVARVRLGEH 126
            |:||.:|..|..||   :.|...:.|.    :|.|:||..|:|||||||  ||:....:|||||:
  Fly    40 IIGGRDAIINSNPW---MAYIHSSVKL----ICGGTLITQRFVLTAAHC--VNEGSAVKVRLGEY 95

  Fly   127 DTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPI 191
            |.....|.     .:||..|...:.|||:...|.::  ...::.||||||||...|.:...|.||
  Fly    96 DDTATEDC-----NSKICIPRAEEHDVDMAFRHGKF--SEIKNLNDIALLRLAKFVTFKAHISPI 153

  Fly   192 CIWPGIELSTSSFKNFP----FQIAGWGDSGLQQKSTVLRQGTISGMSPDECLNRYPTLLVDKDI 252
            |    |.|.||..:...    |...|||::...:...||:...:...:..:|:.....|:  :..
  Fly   154 C----IILGTSKRELVDSIEWFVATGWGETRTHRTRGVLQITQLQRYNSSQCMQALGRLV--QQN 212

  Fly   253 QICAMGWDGTDTGLGDSGSPLMASVGRGAD-----QFYYLAGITSYGGGPSSYGYGPAVYTKTSS 312
            |||| |..|:||..||||.||..:| |..|     ||    |:.|||....|   |..|||...|
  Fly   213 QICA-GRLGSDTCNGDSGGPLFQTV-RHMDKMRPVQF----GVVSYGSRECS---GIGVYTDVYS 268

  Fly   313 YYEWI 317
            |.:||
  Fly   269 YADWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 94/265 (35%)
Tryp_SPc 62..317 CDD:214473 92/263 (35%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 92/263 (35%)
Tryp_SPc 40..276 CDD:238113 94/265 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463638
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.