powered by:
Protein Alignment CG12133 and Erasp
DIOPT Version :10
| Sequence 1: | NP_610540.2 |
Gene: | CG12133 / 36036 |
FlyBaseID: | FBgn0033469 |
Length: | 340 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_725487.1 |
Gene: | Erasp / 246448 |
FlyBaseID: | FBgn0050090 |
Length: | 291 |
Species: | Drosophila melanogaster |
| Alignment Length: | 40 |
Identity: | 11/40 - (27%) |
| Similarity: | 16/40 - (40%) |
Gaps: | 15/40 - (37%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 390 SYEVHSNFISDSYGAPPVDSFLPGKYKPSFAKPLAPPPQK 429
:||: .||| |:|..:|...|...|:|
Fly 475 NYEI----------LPPV-----GRYDETFIAELILRPEK 499
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG12133 | NP_610540.2 |
Tryp_SPc |
62..317 |
CDD:214473 |
|
| Erasp | NP_725487.1 |
Tryp_SPc |
40..276 |
CDD:238113 |
|
|
Blue background indicates that the domain is not in
the aligned region.
|
Return to query results.
Submit another query.
