DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG30088

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:277 Identity:89/277 - (32%)
Similarity:131/277 - (47%) Gaps:38/277 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LPDSRVCGQSPPSSYIVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCL 111
            :|...|..:|..::.||.|.||.....|:...|.|.:       ...|.|::|:|||:||||||:
  Fly    30 IPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSS-------EIHCGGTIISSRYILTAAHCM 87

  Fly   112 NVNDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHY-NDIAL 175
            ..   |: :|||||||...:||.    .|.....||. :.|:.|...    |.|..|.. |||||
  Fly    88 RP---YL-KVRLGEHDITRNPDC----QGGSCSPPAE-EFDIVLATK----YKRFDRFLANDIAL 139

  Fly   176 LRLKSRVKYTLQIRPICIWPGIELSTSSFKN-FPFQIAGWGDSGLQQKSTVLRQGTISGMSPDEC 239
            |:|...:::.:.|:|||    :.|:.::..| ..||..|||.:.....:.||:...::...    
  Fly   140 LKLSRNIRFNVHIQPIC----LILNPAAAPNVHEFQAFGWGQTETNHSANVLQTTVLTRYD---- 196

  Fly   240 LNRYPTLLVDKDI---QICAMGWDGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYG 301
             ||:...::...|   |:| :|:.|:||..||||.||:..|.......|...||.|:|.....  
  Fly   197 -NRHCRSVLSMPITINQLC-VGFQGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDKCQ-- 257

  Fly   302 YGPAVYTKTSSYYEWIK 318
             .|.|||...:|..||:
  Fly   258 -SPGVYTYVPNYIRWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 86/262 (33%)
Tryp_SPc 62..317 CDD:214473 84/259 (32%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 84/260 (32%)
Tryp_SPc 45..273 CDD:238113 85/260 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463539
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.