DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG30083

DIOPT Version :10

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:152 Identity:30/152 - (19%)
Similarity:52/152 - (34%) Gaps:42/152 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   528 LPSEQPARPF--------------LTQHQLPEAQSYVQEPRYQAHDVVSVSSDCGHGPTSVDVQQ 578
            |||....|.|              .....|.:..:||..|       |..::||..|.:.  ::.
  Fly   187 LPSRSDTRTFAGLMGTVSGYGIYSTANPALSDVLNYVLNP-------VMTNADCRAGWSG--LEW 242

  Fly   579 SIQTNQLSIVGPSATASYSADYSNSHSAQEHYAGESSSRHVQA-SSLPGLDGGLGGLELISAQKS 642
            .|:...:...|....|:.::|.....:.|:  :|||....|.: .|..|.|.|            
  Fly   243 LIEAQNICQSGDGGRAACNSDSGGPLTVQD--SGESLQVGVVSFGSSVGCDNG------------ 293

  Fly   643 QSLTIPVQGQHGSYHLQFQSAD 664
                :|......:|:|::..|:
  Fly   294 ----VPTVFARVTYYLEWIEAN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..317 CDD:214473
CG30083NP_725492.3 Tryp_SPc 34..255 CDD:238113 15/76 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.