DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and C1s

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_620255.2 Gene:C1s / 192262 RGDID:619983 Length:694 Species:Rattus norvegicus


Alignment Length:315 Identity:90/315 - (28%)
Similarity:124/315 - (39%) Gaps:83/315 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GDKLPDS-RVCGQSPPSSY-----IVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASR 102
            |.:||.. .||| .|...:     |.||...:...|||.|..          .||...|:||...
  Rat   421 GVELPKCIPVCG-VPTEPFKVQQRIFGGYSTKIQSFPWQVYF----------ESPRGGGALIDEY 474

  Fly   103 YVLTAAHCLNVND---FYVARVRLGEHDTENDPDYTWLPNGAKI----------WAPAHVDIDVD 154
            :||||||.:..|.   .||....|         ....|.|..::          |..   :.|::
  Rat   475 WVLTAAHVVEGNSDPVMYVGSTLL---------KIERLRNAQRLITERVIIHPSWKQ---EDDLN 527

  Fly   155 LRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQ-----IAGW 214
            .|...:          |||||::||..||....:.|||: |    .|||..| |.:     |:||
  Rat   528 TRTNFD----------NDIALVQLKDPVKMGPTVAPICL-P----ETSSDYN-PSEGDLGLISGW 576

  Fly   215 GDSGLQQKSTVLRQGTISGMSPDEC-----------LNRYPTLLVDKDIQICAMGWDGTDTGLGD 268
            |.:..:.....||...:...|.::|           .|.|    |..|..||| |..|.|:..||
  Rat   577 GRTENRTNVIQLRGAKLPITSLEKCQQVKVENPKARSNDY----VFTDNMICA-GEKGVDSCEGD 636

  Fly   269 SGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYGPAVYTKTSSYYEWIKKKIND 323
            ||......|....|..:|:||:.|:|....:||    :|||..:|.:||.|.:.:
  Rat   637 SGGAFALPVPNVKDPKFYVAGLVSWGKKCGTYG----IYTKVKNYVDWILKTMQE 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 82/286 (29%)
Tryp_SPc 62..317 CDD:214473 80/283 (28%)
C1sNP_620255.2 CUB 24..135 CDD:238001
FXa_inhibition 149..177 CDD:405372
CUB 181..293 CDD:395345
CCP 300..361 CDD:153056
CCP 365..428 CDD:153056 3/6 (50%)
Tryp_SPc 443..681 CDD:214473 80/284 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.