DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and try-4

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:289 Identity:66/289 - (22%)
Similarity:105/289 - (36%) Gaps:62/289 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAH------------CLNVN----- 114
            |::...|||.|....:...       ...||:|:..:::||||            |.|.|     
 Worm    52 ESKIKNFPWAVSFTVDGVN-------RLGGSIISPYHIITAAHGFITTIGSRGNLCENKNWKKPN 109

  Fly   115 -DFY--------VARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHY 170
             ..|        ..:|..|........|.  .||..:......:...|...:...::.:.|....
 Worm   110 SSIYRSIKFLRDTRKVAYGGTCIRGHTDK--YPNDPRCKKSDVIHNKVRAVLVDGEFASSNCLKG 172

  Fly   171 NDIALLRLKSRVKYTLQIRPICI-WPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGM 234
            :|.|::.::.|:.::..:||||: .|.:..:.|      ..:.|||.|.:..:|..|.......:
 Worm   173 HDWAIVEVEKRIHFSENVRPICLPRPNMYYTKS------LAVPGWGRSYIFNESGPLIHEIPMRI 231

  Fly   235 SPDECLNRYPTLL-VDKDIQICA-----MGWDGTDTGLGDSGSPLM---ASVGRGADQFYYLAGI 290
            ..| |...:...| .|.|..|||     ..:....|..||||..|.   .:.||.     :|..|
 Worm   232 DRD-CKRPWSDRLPADADDFICATSMNVSNYSAPRTCHGDSGGGLEYRDDNYGRA-----FLIAI 290

  Fly   291 TSYG--GGPSSYGYGPAVYTKTSSYYEWI 317
            ||:|  |.||:.   .|.:|:...|...|
 Worm   291 TSFGTRGCPSNM---LARFTRVDMYLNLI 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 66/289 (23%)
Tryp_SPc 62..317 CDD:214473 65/287 (23%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 66/289 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.