DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and svh-1

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:280 Identity:72/280 - (25%)
Similarity:111/280 - (39%) Gaps:64/280 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 IVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCL----NVNDFYVARVR 122
            :|||.|.....||||..|..:|..|..     |..|::...:::|||||.    .|:.:.|.   
 Worm   713 VVGGFETVPGAFPWTAALRNKATKAHH-----CGASILDKTHLITAAHCFEEDERVSSYEVV--- 769

  Fly   123 LGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHY---------NDIALLRL 178
            :|:.| .|..|                        .:||.:.....|:         :|||:|.:
 Worm   770 VGDWD-NNQTD------------------------GNEQIFYLQRIHFYPLYKDIFSHDIAILEI 809

  Fly   179 K-SRVKYTLQIRPICIWPGIELSTSSFKNFPFQ---IAGWGDSGLQQKSTVLRQGTISGMSPDEC 239
            . ..:::....:|||      |.:..|...|.:   ::|||..||:.... |:...|..::..:|
 Worm   810 PYPGIEFNEYAQPIC------LPSKDFVYTPGRQCVVSGWGSMGLRYAER-LQAALIPIINRFDC 867

  Fly   240 LNRYPTLLVDKDIQICAMGW--DGTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGY 302
            :|.............|| |:  .|.|:..||||.|...   |..|..:.|||:.|:|.| .:...
 Worm   868 VNSSQIYSSMSRSAFCA-GYLEGGIDSCQGDSGGPFAC---RREDGAFVLAGVISWGDG-CAQKK 927

  Fly   303 GPAVYTKTSSYYEWIKKKIN 322
            .|.:||..:.|..||...||
 Worm   928 QPGIYTMVAPYLSWISAIIN 947

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 70/276 (25%)
Tryp_SPc 62..317 CDD:214473 68/273 (25%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996
Tryp_SPc 713..945 CDD:238113 70/276 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.