DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and F10

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001229297.1 Gene:F10 / 14058 MGIID:103107 Length:493 Species:Mus musculus


Alignment Length:294 Identity:80/294 - (27%)
Similarity:129/294 - (43%) Gaps:76/294 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 IVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDFYVARVRLGEH 126
            ||||.|.:..:.||..||      ..:.....|.|:::...|:|||||||:....:  :||:|:.
Mouse   244 IVGGRECKDGECPWQALL------INEDNEGFCGGTILNEFYILTAAHCLHQARRF--KVRVGDR 300

  Fly   127 DTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPI 191
            :||.:       .|.::   .|   :||:.:.|.: :.|:...| |||:||||:.:.:.:.:.|.
Mouse   301 NTEKE-------EGNEM---VH---EVDVVIKHNK-FQRDTYDY-DIAVLRLKTPITFRMNVAPA 350

  Fly   192 CIWPGIELSTSSFKNFPFQIAGWGDSGLQQKSTVLRQGTISGMSPDECLNRYPTLL-------VD 249
            |:              |.:  .|.:|.|..:.|    |.:||........|...:|       ||
Mouse   351 CL--------------PQK--DWAESTLMTQKT----GIVSGFGRTHEKGRQSNILKMLEVPYVD 395

  Fly   250 KDI------------QICAMGWDG--TDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSY 300
            ::.            ..|| |::.  .|...||||.|.:...    ...||:.||.|:|.|.:..
Mouse   396 RNTCKLSTSFSITQNMFCA-GYEAKLEDACQGDSGGPHVTRF----KNTYYVTGIVSWGEGCARK 455

  Fly   301 G-YGPAVYTKTSSYYEWI----KKKINDIAEDER 329
            | ||  :|||.:::.:||    |.::...||..|
Mouse   456 GKYG--IYTKVTTFLKWIDRSMKARVGPTAETPR 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 77/283 (27%)
Tryp_SPc 62..317 CDD:214473 74/276 (27%)
F10NP_001229297.1 GLA 36..97 CDD:214503
EGF_CA 98..134 CDD:238011
FXa_inhibition 141..176 CDD:291342
Tryp_SPc 243..471 CDD:214473 74/276 (27%)
Tryp_SPc 244..473 CDD:238113 76/278 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.