DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and Klk1b9

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_034246.1 Gene:Klk1b9 / 13648 MGIID:95293 Length:261 Species:Mus musculus


Alignment Length:270 Identity:79/270 - (29%)
Similarity:116/270 - (42%) Gaps:43/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PPSSYIVGGMEAQSNQFPWTV-LLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDFYVA- 119
            |..|.||||.:.:.|..||.| :..|..|        :|.|.|:.:.:|||||||     :|.. 
Mouse    20 PVHSRIVGGFKCEKNSQPWHVAVYRYNEY--------ICGGVLLDANWVLTAAHC-----YYEEN 71

  Fly   120 RVRLGEHDT-ENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVK 183
            :|.||:::. |.:|.............|.:........:.|.:|     .:.||:.||||.....
Mouse    72 KVSLGKNNLYEEEPSAQHRLVSKSFLHPGYNRSLHRNHIRHPEY-----DYSNDLMLLRLSKPAD 131

  Fly   184 YTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDSG--LQQKSTVLRQGTISGMSPDECLNRYPTL 246
            .|..::||.: |..|....|    ....:|||.:.  ..|.:..|:...:..:..::|...:   
Mouse   132 ITDVVKPIAL-PTEEPKLGS----TCLASGWGSTTPFKFQNAKDLQCVNLKLLPNEDCGKAH--- 188

  Fly   247 LVDK--DIQICAMGWD-GTDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYGPAVYT 308
             ::|  |:.:||...| |.||..||||.||:..   |.     |.||||:|..|......|.|||
Mouse   189 -IEKVTDVMLCAGETDGGKDTCKGDSGGPLICD---GV-----LQGITSWGFTPCGEPKKPGVYT 244

  Fly   309 KTSSYYEWIK 318
            |...:..|||
Mouse   245 KLIKFTSWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 77/265 (29%)
Tryp_SPc 62..317 CDD:214473 74/262 (28%)
Klk1b9NP_034246.1 Tryp_SPc 24..253 CDD:214473 74/263 (28%)
Tryp_SPc 25..256 CDD:238113 77/265 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.