DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG43124

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:259 Identity:65/259 - (25%)
Similarity:98/259 - (37%) Gaps:84/259 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 MCAGSLIASRYVLTAAHCLNVNDFYVARVRLGEHDT--EN---DPDYTWLPNGAKIWAPAHVDID 152
            :|||:||.:.||||||.|...|:....|:..|..|.  ||   ...|.|:.:     .||:    
  Fly    53 ICAGALINNLYVLTAASCFKENEKLTVRLGSGYFDKSYENFRVTKAYFWMTH-----FPAN---- 108

  Fly   153 VDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPICIWPGIELSTSSFKNFPFQIAGWGDS 217
                            :.|::.:.||::.|::...|||:||       |.|.|:.          
  Fly   109 ----------------NTNNLCIFRLQTEVEFKTHIRPMCI-------TKSPKSL---------- 140

  Fly   218 GLQQKSTVLRQGTISGMSPDECLNRYPTL-LVDKDIQ--IC--AMG-----WDGTDTGLGDSGSP 272
            ||   :|..           |.:|..|.: ...|:|:  .|  ..|     |....|     |||
  Fly   141 GL---ATTF-----------EIINEKPKMWYFCKNIKGLFCKYVFGENEEKWQSKPT-----GSP 186

  Fly   273 LMASVGRGADQFYYLAGITSYGGGPSSYGYGPAVYTKTSSYYEWIKKKIN---DIAEDERKMKY 333
            ...::..|..:.....||.||... .:|   ..||....|:..|| .:|:   ||:...:|.:|
  Fly   187 WTETISNGPFKGLVRYGILSYRDN-KTY---DEVYINVMSHINWI-AQISLEIDISTPVKKKEY 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 60/241 (25%)
Tryp_SPc 62..317 CDD:214473 58/238 (24%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 29/104 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.