DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12133 and CG42694

DIOPT Version :9

Sequence 1:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:233 Identity:62/233 - (26%)
Similarity:99/233 - (42%) Gaps:42/233 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 MCAGSLIASRYVLTAAHCLNVNDFYVARVRLGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRV 157
            :|:||||:.::||:||.|::|:....  |:||..:....|.:..:.|   :..|:|         
  Fly    57 LCSGSLISKQFVLSAAQCIDVHGKLF--VQLGVSNATKSPHWYTVSN---VVIPSH--------- 107

  Fly   158 PHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPICIWPGIELSTSS------FKNFPFQIAGWGD 216
                   ...|...||.||:|...|.|...:.|||    |.|:|::      .:|  |..:.|..
  Fly   108 -------SGKRLQRDIGLLKLSQSVDYNDFVYPIC----IALNTNTLDMVKILQN--FTTSAWLS 159

  Fly   217 SGLQQKSTVLRQGTISGMSPDECLNRYPTLLVDKDIQICAMGWDGTDTGLGDSGSPLMASVGRGA 281
            .....::.||.|     :|.|.|.......:..|  :|||......::...||||.|...:.:|:
  Fly   160 KNKNPQTIVLSQ-----LSRDRCKLNLSGNVTPK--EICAASLQRNNSCFIDSGSALTQPIIQGS 217

  Fly   282 DQF-YYLAGITSYGGGPSSYGYGPAVYTKTSSYYEWIK 318
            :.. ..|.||..|..| .|:...||:|...:....||:
  Fly   218 NIVREMLFGIRGYVNG-RSWCSEPAIYIDVAECVGWIE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 62/233 (27%)
Tryp_SPc 62..317 CDD:214473 60/230 (26%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 62/233 (27%)
Tryp_SPc 46..253 CDD:214473 60/230 (26%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463682
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.