DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1418 and PRA7

DIOPT Version :9

Sequence 1:NP_610539.1 Gene:CG1418 / 36035 FlyBaseID:FBgn0033468 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_564679.1 Gene:PRA7 / 841962 AraportID:AT1G55190 Length:189 Species:Arabidopsis thaliana


Alignment Length:185 Identity:43/185 - (23%)
Similarity:83/185 - (44%) Gaps:27/185 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SLPSLSNLPSP---LQIFQMVRNSL-------RPWVVFFNINNFKTAISMQRLNSRVIRNLSYFQ 82
            ::|:.|: |||   |:.....::.:       |||...|:..:...........||:..||.||:
plant     6 AIPTSSH-PSPAIDLEYISRAKHRIKSGLATRRPWKSMFDFESMTLPHGFFDAISRIKTNLGYFR 69

  Fly    83 ANY----VFIFFVLMIYCLITAPCILLVI-LASAFGCHKLRVRNSNITIVGQQLTPSQQIIALNL 142
            |||    :||.|:.::|    .|..|:|: :...|......:|:..:.:.|.|:.....:|.|::
plant    70 ANYAIGVLFILFLSLLY----HPTSLIVLSILVVFWIFLYFLRDEPLVVFGYQIDDRTVLIGLSV 130

  Fly   143 ATAPVLFLVGAGAVLFWTLGASCFVIAMHA-------IFYNIDAIVTEENEGFLA 190
            .|..:|.|..|.:.:..:|..:..::.:||       :|.:.:|....|..|.::
plant   131 LTVVMLLLTHATSNILGSLLTAAVLVLIHAAVRRSDNLFLDEEAAAVTEASGLMS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1418NP_610539.1 PRA1 48..178 CDD:281235 34/148 (23%)
PRA7NP_564679.1 PRA1 31..171 CDD:397359 34/143 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I3740
eggNOG 1 0.900 - - E1_KOG3142
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I2495
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1344798at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19317
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.930

Return to query results.
Submit another query.