DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1418 and PRA1.F1

DIOPT Version :9

Sequence 1:NP_610539.1 Gene:CG1418 / 36035 FlyBaseID:FBgn0033468 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_173212.1 Gene:PRA1.F1 / 838346 AraportID:AT1G17700 Length:180 Species:Arabidopsis thaliana


Alignment Length:155 Identity:39/155 - (25%)
Similarity:67/155 - (43%) Gaps:7/155 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IFQMVRNSL---RPWVVFFNINNFKTAISMQRLNSRVIRNLSYFQANYVFIFFVLMIYCLITAPC 102
            |.|..|:.|   |||....::.:|.....:..:.:|:..|..|||.||..:....:...||..|.
plant    25 INQHKRSGLATRRPWKQMLDLGSFNFPRKLATVITRIRANTVYFQTNYTIVVLFSVFLSLIWNPF 89

  Fly   103 ILLVILASAFGCHKLR--VRNSNITIVGQQLTPSQQIIALNLATAPVLFLVGAGAVLFWTLGASC 165
            .|||:|| ..|.....  :|:..:|:..:::.....:|.:::.|..:|||..|...:...:.|..
plant    90 SLLVLLA-LLGAWLFLYFLRDEPLTVFDREIDHRIVLIIMSVITLSILFLTDAKLNIAVAIVAGA 153

  Fly   166 FVIAMH-AIFYNIDAIVTEENEGFL 189
            ..:..| |:....|...|:|....|
plant   154 LAVLSHAAVRKTEDLFQTDEETSLL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1418NP_610539.1 PRA1 48..178 CDD:281235 32/135 (24%)
PRA1.F1NP_173212.1 PRA1 31..169 CDD:397359 33/138 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I3740
eggNOG 1 0.900 - - E1_KOG3142
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I2495
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1344798at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19317
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.930

Return to query results.
Submit another query.