DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1418 and Rabac1

DIOPT Version :9

Sequence 1:NP_610539.1 Gene:CG1418 / 36035 FlyBaseID:FBgn0033468 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_113962.1 Gene:Rabac1 / 83583 RGDID:621002 Length:185 Species:Rattus norvegicus


Alignment Length:159 Identity:56/159 - (35%)
Similarity:92/159 - (57%) Gaps:4/159 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LPSLSNLPSPLQIFQMVRNSLRPWVVFFNINNFKTAISMQRLNSRVIRNLSYFQANYVFIFFVLM 93
            ||.|....:..:..:..|.::|||..|.:...|....::..|..|::||:.|:|:||||:|..|:
  Rat    22 LPKLIPSGAGREWLERRRATIRPWGTFVDQQRFSRPRNVGELCQRLVRNVEYYQSNYVFVFLGLI 86

  Fly    94 IYCLITAPCILLVILASAFG-CH--KLRVRNSNITIVGQQLTPSQQIIALNLATAPVLFLVGAGA 155
            :||::|:| :|||.||..|| |:  .||...|.:.:.|::::|:.|.......:.|..:|.|||:
  Rat    87 LYCVVTSP-MLLVALAVFFGACYILYLRTLQSKLVLFGREVSPAHQYALAGGVSFPFFWLAGAGS 150

  Fly   156 VLFWTLGASCFVIAMHAIFYNIDAIVTEE 184
            .:||.|||:..:|..||.|:.|:....||
  Rat   151 AVFWVLGATLVLIGSHAAFHQIEPADGEE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1418NP_610539.1 PRA1 48..178 CDD:281235 49/132 (37%)
Rabac1NP_113962.1 Required for interaction with prenylated RAB3A and VAMP2 30..54 5/23 (22%)
PRA1 38..170 CDD:397359 49/132 (37%)
Required for interaction with GDI1. /evidence=ECO:0000269|PubMed:10751420 165..185 6/15 (40%)
Homodimerization. /evidence=ECO:0000250 175..185 2/5 (40%)
Required for interaction with prenylated RAB3A and VAMP2 175..185 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353232
Domainoid 1 1.000 99 1.000 Domainoid score I6937
eggNOG 1 0.900 - - E1_KOG3142
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38182
Inparanoid 1 1.050 104 1.000 Inparanoid score I4855
OMA 1 1.010 - - QHG52029
OrthoDB 1 1.010 - - D1344798at2759
OrthoFinder 1 1.000 - - FOG0006570
OrthoInspector 1 1.000 - - oto97596
orthoMCL 1 0.900 - - OOG6_102188
Panther 1 1.100 - - LDO PTHR19317
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6316
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.