DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1418 and PRA1.B3

DIOPT Version :9

Sequence 1:NP_610539.1 Gene:CG1418 / 36035 FlyBaseID:FBgn0033468 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001330011.1 Gene:PRA1.B3 / 830420 AraportID:AT5G05380 Length:284 Species:Arabidopsis thaliana


Alignment Length:191 Identity:48/191 - (25%)
Similarity:84/191 - (43%) Gaps:23/191 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HTGGNLSGNMQPPPPSGGRFSVDMQSLPSLSNLPSPLQIFQMVRNSL---RPWVVFFNINNFKTA 64
            |:||   |:....|.|...|...:..|.|            .:|.||   |||:...:.:.....
plant    80 HSGG---GSQSQQPVSTPAFRTFLSRLSS------------SIRQSLSQRRPWLELVDRSAISRP 129

  Fly    65 ISMQRLNSRVIRNLSYFQANYVFIFFVLMIYCLITAPCILLVIL----ASAFGCHKLRVRNSNIT 125
            .|:....||:.|||.||:.|||.|..:::...|::.|..|||:|    |..| .:..|..:..:.
plant   130 ESLTDAYSRIRRNLPYFKVNYVTIVSLVLALSLLSHPFSLLVLLCLFCAWIF-LYLFRPSDQPLV 193

  Fly   126 IVGQQLTPSQQIIALNLATAPVLFLVGAGAVLFWTLGASCFVIAMHAIFYNIDAIVTEENE 186
            ::|:..:..:.:..|.:.|..|:||...|::|...|.....::.:|..|...:.:..::.|
plant   194 VLGRTFSDRETLGVLVILTIVVVFLTSVGSLLTSALMIGFGIVCLHGAFRVPEDLFLDDQE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1418NP_610539.1 PRA1 48..178 CDD:281235 37/136 (27%)
PRA1.B3NP_001330011.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I3740
eggNOG 1 0.900 - - E1_KOG3142
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I2495
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1344798at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102188
Panther 1 1.100 - - O PTHR19317
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.