DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1418 and PRA1.B1

DIOPT Version :9

Sequence 1:NP_610539.1 Gene:CG1418 / 36035 FlyBaseID:FBgn0033468 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001190100.1 Gene:PRA1.B1 / 824777 AraportID:AT3G56110 Length:209 Species:Arabidopsis thaliana


Alignment Length:185 Identity:46/185 - (24%)
Similarity:85/185 - (45%) Gaps:11/185 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MQPPPPSGGRFSVDMQSLPSLSNLPSPLQIFQMVRNSL-------RPWVVFFNINNFKTAISMQR 69
            |..||.........:||.|.: |.|:....|..:..|:       |||....:.::.....|:..
plant     1 MATPPTLPVTNQQAVQSQPPI-NTPAFRTFFSRLSTSIRDGLSQRRPWTELIDRSSMARPESLTD 64

  Fly    70 LNSRVIRNLSYFQANYVFIFFVLMIYCLITAPCILLVILASAFG---CHKLRVRNSNITIVGQQL 131
            ..||:.:||:||:.|||.|..:::.:.|.:.|..|||::....|   .:..|..:..:.:.|:..
plant    65 ALSRIRKNLAYFKVNYVAIVSLVLAFSLFSHPLSLLVLIGLLGGWMFLYLFRPSDQPLVVFGRTF 129

  Fly   132 TPSQQIIALNLATAPVLFLVGAGAVLFWTLGASCFVIAMHAIFYNIDAIVTEENE 186
            :..:.::||.|:|..|:|:...|::|...|.....::.:|..|...|.:..:|.|
plant   130 SDRETLLALVLSTIVVVFMTSVGSLLTSALMIGVAIVCVHGAFVVPDDLFLDEQE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1418NP_610539.1 PRA1 48..178 CDD:281235 34/139 (24%)
PRA1.B1NP_001190100.1 PRA1 39..181 CDD:397359 34/141 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I3740
eggNOG 1 0.900 - - E1_KOG3142
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I2495
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1344798at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102188
Panther 1 1.100 - - LDO PTHR19317
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.