DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1418 and PRA8

DIOPT Version :10

Sequence 1:NP_610539.1 Gene:CG1418 / 36035 FlyBaseID:FBgn0033468 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_566461.1 Gene:PRA8 / 820581 AraportID:AT3G13720 Length:188 Species:Arabidopsis thaliana


Alignment Length:143 Identity:32/143 - (22%)
Similarity:64/143 - (44%) Gaps:10/143 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RPWVVFFNINNFKTAISMQRLNSRVIRNLSYFQANYVFIFFVLMIYCLITAPCILLV--ILASAF 112
            |.|.|.|:.::......:....:|:..||:||:.||..:..:::.:.||..|..|:|  :|...:
plant    37 RAWRVMFDFHSMGLPHGVSDAFTRIKTNLAYFRMNYAIVVLIVIFFSLIWHPTSLIVFTVLVVVW 101

  Fly   113 GCHKLRVRNSNITIVGQQLTPSQQIIALNLATAPVLFLVGAGAVLFWTLGASCFVIAMHAI---- 173
             .....:|:..|.:...|:.....:|.|::.|..:|.|..|...:...|.....::.:|::    
plant   102 -IFLYFLRDEPIKLFRFQIDDRTVLIVLSVLTVVLLLLTNATFNIVGALVTGAVLVLIHSVVRKT 165

  Fly   174 ---FYNIDAIVTE 183
               |.:.:|..||
plant   166 EDLFLDEEAATTE 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1418NP_610539.1 PRA1 48..178 CDD:460846 29/136 (21%)
PRA8NP_566461.1 PRA1 32..171 CDD:460846 29/134 (22%)

Return to query results.
Submit another query.