DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1418 and PRA1.B4

DIOPT Version :9

Sequence 1:NP_610539.1 Gene:CG1418 / 36035 FlyBaseID:FBgn0033468 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_181370.1 Gene:PRA1.B4 / 818416 AraportID:AT2G38360 Length:220 Species:Arabidopsis thaliana


Alignment Length:187 Identity:50/187 - (26%)
Similarity:85/187 - (45%) Gaps:15/187 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PSGGRFSVDMQ---SLPSLSNLPSPLQIFQMVRNSL---RPWVVFFNINNFKTAISMQRLNSRVI 75
            ||....||:.|   :.|:..|..:  ||.:.|:|.|   |||....:.:......|:.....|:.
plant    18 PSAAPSSVESQPPIATPAFRNFIN--QITETVKNGLSKRRPWAELADRSALSKPESISDAAVRIR 80

  Fly    76 RNLSYFQANYVFIFFVLMIYCLITAP---CILLVILASAFGCHKLRVRNSNITIVGQQLTPSQQI 137
            :|.|||:.||:.:...::.:.|:|.|   ..||.:|||....:..|..:..|.:.|:..:..:.:
plant    81 KNYSYFKVNYLTVATAIVGFSLVTHPFSLVFLLCLLASWLFLYLFRPTDQPIVLFGRTFSDRETL 145

  Fly   138 IALNLATAPVLFLVGAGAVLFWTLGASCFVIAMHAIFYNIDAIVTEENE----GFLA 190
            ..|.|.:..|:||...|:||...:.....:|..|..|...:.:..:|.|    |||:
plant   146 GCLILFSIFVIFLTDVGSVLVSAMMIGVALICAHGAFRAPEDLFLDEQEPAATGFLS 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1418NP_610539.1 PRA1 48..178 CDD:281235 34/135 (25%)
PRA1.B4NP_181370.1 PRA1 50..191 CDD:397359 34/140 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I3740
eggNOG 1 0.900 - - E1_KOG3142
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I2495
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1344798at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102188
Panther 1 1.100 - - O PTHR19317
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.