DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1418 and AT4G00005

DIOPT Version :9

Sequence 1:NP_610539.1 Gene:CG1418 / 36035 FlyBaseID:FBgn0033468 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001154191.1 Gene:AT4G00005 / 6241005 AraportID:AT4G00005 Length:118 Species:Arabidopsis thaliana


Alignment Length:93 Identity:26/93 - (27%)
Similarity:47/93 - (50%) Gaps:3/93 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SRVIRNLSYFQANYVFIFFVLMIYCLITAP---CILLVILASAFGCHKLRVRNSNITIVGQQLTP 133
            :|..:|.|||:.|||.|..:::.:.|...|   .:||.:.||....:..|..:..:.::|:..:.
plant     2 TRFWKNSSYFRVNYVCIIALIISFSLPAHPFSLILLLCLAASWLFLYLFRPSDRPLILIGRSFSE 66

  Fly   134 SQQIIALNLATAPVLFLVGAGAVLFWTL 161
            .:.:..|.|:|..|:|....|:||...|
plant    67 YETLGGLILSTIAVIFFTSVGSVLISAL 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1418NP_610539.1 PRA1 48..178 CDD:281235 26/93 (28%)
AT4G00005NP_001154191.1 PRA1 1..101 CDD:281235 26/93 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I3740
eggNOG 1 0.900 - - E1_KOG3142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1344798at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19317
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.