DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1418 and rabac1

DIOPT Version :9

Sequence 1:NP_610539.1 Gene:CG1418 / 36035 FlyBaseID:FBgn0033468 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_999945.1 Gene:rabac1 / 407650 ZFINID:ZDB-GENE-040625-146 Length:190 Species:Danio rerio


Alignment Length:176 Identity:58/176 - (32%)
Similarity:90/176 - (51%) Gaps:13/176 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FSVDMQSLPSLSN-----LPSPLQ---IFQMV---RNSLRPWVVFFNINNFKTAISMQRLNSRVI 75
            ||.:.:.||....     ||..|.   |...|   |.|:|||..|.:...|....:...|..||:
Zfish     9 FSSEAEQLPGAGIVGRLWLPKGLSGNVIKDWVDRRRKSIRPWAGFVDQRKFSKPRNFGELCQRVV 73

  Fly    76 RNLSYFQANYVFIFFVLMIYCLITAPCILLV--ILASAFGCHKLRVRNSNITIVGQQLTPSQQII 138
            |||..:.:||.|||..|::||:|::|.:|:.  :.|.||....|:.....:.:.|::||...|:.
Zfish    74 RNLDTYHSNYTFIFMALILYCIISSPMLLIALGVFAGAFYIIHLKTLEKKLVVFGRELTQGHQLG 138

  Fly   139 ALNLATAPVLFLVGAGAVLFWTLGASCFVIAMHAIFYNIDAIVTEE 184
            .....:.||.:|.|||:.:||.|||:..||..||.|:.:::...:|
Zfish   139 LAGGVSFPVFWLAGAGSAVFWVLGATLAVIGSHAAFHELESPDVDE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1418NP_610539.1 PRA1 48..178 CDD:281235 47/131 (36%)
rabac1NP_999945.1 PRA1 46..176 CDD:281235 47/129 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595316
Domainoid 1 1.000 99 1.000 Domainoid score I7085
eggNOG 1 0.900 - - E1_KOG3142
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38182
Inparanoid 1 1.050 103 1.000 Inparanoid score I4954
OMA 1 1.010 - - QHG52029
OrthoDB 1 1.010 - - D1344798at2759
OrthoFinder 1 1.000 - - FOG0006570
OrthoInspector 1 1.000 - - oto38779
orthoMCL 1 0.900 - - OOG6_102188
Panther 1 1.100 - - LDO PTHR19317
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R979
SonicParanoid 1 1.000 - - X6316
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.