DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1418 and PRA1.C

DIOPT Version :9

Sequence 1:NP_610539.1 Gene:CG1418 / 36035 FlyBaseID:FBgn0033468 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001329495.1 Gene:PRA1.C / 28720190 AraportID:AT4G29658 Length:190 Species:Arabidopsis thaliana


Alignment Length:157 Identity:39/157 - (24%)
Similarity:65/157 - (41%) Gaps:14/157 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SLPSLSNLPSPL-------QIFQMVRNSLRPWVVFFNINNFKTAISMQRLNSRVIRNLSYFQANY 85
            ::||..|..|.|       ::..:..:|.|||:.....:.|...||......|:..|:..|:.||
plant     6 TIPSQENASSSLSLLGRAKELISLGLSSQRPWLELVQCSAFSLPISFSVATERIKSNIMIFRTNY 70

  Fly    86 VFIFFVLMIYCLITAPCIL--LVILASAFGCHKLRVRNSNITIVGQQLTPSQQIIALNLATAPVL 148
            :.||.|.:...::..|..|  .|||..|: .:.....|....|.|..:..|..::.|.:.|..:.
plant    71 IVIFIVSIFISMLWQPVHLSVFVILIVAW-LYVYSRDNEPWVIFGSVIDDSTLVLVLLVLTIGIF 134

  Fly   149 FL--VGAGAVLFWTLGASCFVIAMHAI 173
            .|  |..|.|:....|..  |:.:|.:
plant   135 LLTDVSRGIVIGVLAGLP--VVLVHGM 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1418NP_610539.1 PRA1 48..178 CDD:281235 34/130 (26%)
PRA1.CNP_001329495.1 PRA1 30..170 CDD:397359 34/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1344798at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19317
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.