DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1418 and Rabac1

DIOPT Version :9

Sequence 1:NP_610539.1 Gene:CG1418 / 36035 FlyBaseID:FBgn0033468 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_034391.1 Gene:Rabac1 / 14470 MGIID:1201692 Length:185 Species:Mus musculus


Alignment Length:159 Identity:55/159 - (34%)
Similarity:92/159 - (57%) Gaps:4/159 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LPSLSNLPSPLQIFQMVRNSLRPWVVFFNINNFKTAISMQRLNSRVIRNLSYFQANYVFIFFVLM 93
            ||.|....:..:..:..|.::|||..|.:...|....::..|..|::||:.|:|:||||:|..|:
Mouse    22 LPKLIPSGAGREWLERRRATIRPWGTFVDQQRFSRPRNVGELCQRLVRNVEYYQSNYVFVFLGLI 86

  Fly    94 IYCLITAPCILLVILASAFG-CH--KLRVRNSNITIVGQQLTPSQQIIALNLATAPVLFLVGAGA 155
            :||::|:| :|||.||..|| |:  .||...|.:.:.|::::|:.|.......:.|..:|.|||:
Mouse    87 LYCVVTSP-MLLVALAVFFGACYILYLRTLQSKLVLFGREVSPAHQYALAGGVSFPFFWLAGAGS 150

  Fly   156 VLFWTLGASCFVIAMHAIFYNIDAIVTEE 184
            .:||.|||:..:|..||.|:.::....||
Mouse   151 AVFWVLGATLVLIGSHAAFHQMEPADGEE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1418NP_610539.1 PRA1 48..178 CDD:281235 49/132 (37%)
Rabac1NP_034391.1 Required for interaction with prenylated RAB3A and VAMP2. /evidence=ECO:0000250 30..54 5/23 (22%)
PRA1 40..170 CDD:281235 48/130 (37%)
Required for interaction with GDI1. /evidence=ECO:0000250 165..185 5/15 (33%)
Homodimerization 175..185 2/5 (40%)
Required for interaction with prenylated RAB3A and VAMP2. /evidence=ECO:0000250 175..185 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849581
Domainoid 1 1.000 99 1.000 Domainoid score I7121
eggNOG 1 0.900 - - E1_KOG3142
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38182
Inparanoid 1 1.050 103 1.000 Inparanoid score I4948
Isobase 1 0.950 - 0 Normalized mean entropy S3151
OMA 1 1.010 - - QHG52029
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006570
OrthoInspector 1 1.000 - - oto94071
orthoMCL 1 0.900 - - OOG6_102188
Panther 1 1.100 - - LDO PTHR19317
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R979
SonicParanoid 1 1.000 - - X6316
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.