| Sequence 1: | NP_610538.1 | Gene: | Pdrg1 / 36034 | FlyBaseID: | FBgn0033467 | Length: | 132 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001327625.1 | Gene: | AT3G15351 / 820769 | AraportID: | AT3G15351 | Length: | 165 | Species: | Arabidopsis thaliana |
| Alignment Length: | 136 | Identity: | 30/136 - (22%) |
|---|---|---|---|
| Similarity: | 51/136 - (37%) | Gaps: | 25/136 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 5 DLNKSIEIITKTEELADKILVNKQELTVMDKRRQETRQAMRLMEK---SEDKKVWITIGSMLVKM 66
Fly 67 EREKALELLKK--------DQQKIEQQINLIYSDQKVLVNKHRDLEFKSPFSGTHL---KPLEKK 120
Fly 121 EFDALK 126 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | LDO | PTHR21162 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||