DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdrg1 and Pdrg1

DIOPT Version :9

Sequence 1:NP_610538.1 Gene:Pdrg1 / 36034 FlyBaseID:FBgn0033467 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_849270.1 Gene:Pdrg1 / 68559 MGIID:1915809 Length:133 Species:Mus musculus


Alignment Length:133 Identity:41/133 - (30%)
Similarity:75/133 - (56%) Gaps:6/133 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQTDLNKSIEIITKTEELADKILVNKQELTVMDKRRQETRQAMRLMEK----SEDKKVWITIGS 61
            |...:..:.:..:.:.||||:.:|.:|:::..:|.:|.:.|:.:|.::|    |||  |.:..|:
Mouse     1 MLSPEAERVLRYLVEVEELAEAVLSDKRQIVDLDTKRNQNREGLRALQKDLSVSED--VMVCFGN 63

  Fly    62 MLVKMEREKALELLKKDQQKIEQQINLIYSDQKVLVNKHRDLEFKSPFSGTHLKPLEKKEFDALK 126
            |.:||...|..|:::|||:.::::|..:.|..||.||:..:.:.|....|.:|.||...|..|||
Mouse    64 MFIKMPHPKTKEMIQKDQEHLDKEIERLRSQLKVKVNRLFEAQGKPELKGFNLNPLSPDEVKALK 128

  Fly   127 ANL 129
            ..|
Mouse   129 VIL 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdrg1NP_610538.1 None
Pdrg1NP_849270.1 Prefoldin 27..108 CDD:385414 26/84 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837760
Domainoid 1 1.000 49 1.000 Domainoid score I11828
eggNOG 1 0.900 - - E1_2DYP6
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49108
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009723
OrthoInspector 1 1.000 - - oto95280
orthoMCL 1 0.900 - - OOG6_106259
Panther 1 1.100 - - LDO PTHR21162
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5058
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.