DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdrg1 and T07D4.5

DIOPT Version :9

Sequence 1:NP_610538.1 Gene:Pdrg1 / 36034 FlyBaseID:FBgn0033467 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001122634.1 Gene:T07D4.5 / 6418633 WormBaseID:WBGene00045407 Length:142 Species:Caenorhabditis elegans


Alignment Length:118 Identity:34/118 - (28%)
Similarity:61/118 - (51%) Gaps:13/118 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EIITKTEE---LADKILVNKQELTVMDKRRQETRQAMRLMEKSEDKKVWITIGSMLVKMEREKAL 72
            |:..||.|   |:.|:...|:....:|..||:.|:..|.:::.:...|||..|:..::..:..:|
 Worm    23 ELRDKTSEIIYLSTKLNHAKETCVNLDNERQKFREVSRKIKEKDIDPVWIYNGTCFLQTSQANSL 87

  Fly    73 ELLKKDQQKIEQ---QINLIYS---DQKVLVNKHRDLEFKSPFSGTHLKPLEK 119
            .:|:||.:.:|:   ||..:..   |..:.::|.|:||.:    |..||||.|
 Worm    88 NILEKDTKTVEEVRGQIQEVIKKDMDTFLKLHKKRNLEER----GFGLKPLLK 136



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159672
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106259
Panther 1 1.100 - - LDO PTHR21162
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.