DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdrg1 and pdrg1

DIOPT Version :9

Sequence 1:NP_610538.1 Gene:Pdrg1 / 36034 FlyBaseID:FBgn0033467 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001017757.1 Gene:pdrg1 / 550453 ZFINID:ZDB-GENE-050417-276 Length:131 Species:Danio rerio


Alignment Length:121 Identity:36/121 - (29%)
Similarity:67/121 - (55%) Gaps:1/121 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IEIITKTEELADKILVNKQELTVMDKRRQETRQAM-RLMEKSEDKKVWITIGSMLVKMEREKALE 73
            :|.:|:.|..|:.||.:||::..:|.||...|:|: .|...|.:..|.:..|:|.:|..:|....
Zfish     9 LEHLTEVEVAAEDILTDKQQIVDLDVRRNRNREALSALRNNSPNDNVKVCFGNMFIKFPQESTRS 73

  Fly    74 LLKKDQQKIEQQINLIYSDQKVLVNKHRDLEFKSPFSGTHLKPLEKKEFDALKANL 129
            ::.|||::::::|..:.:..|..||:..:|:.|....|.:|.||...|..|:.:.|
Zfish    74 MILKDQEQLDKEITDLRTRLKAKVNRLNELQGKPELRGYNLAPLSSDEVKAINSLL 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdrg1NP_610538.1 None
pdrg1NP_001017757.1 Prefoldin 26..106 CDD:298833 22/79 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581504
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DYP6
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5360
OMA 1 1.010 - - QHG49108
OrthoDB 1 1.010 - - D1630799at2759
OrthoFinder 1 1.000 - - FOG0009723
OrthoInspector 1 1.000 - - oto41108
orthoMCL 1 0.900 - - OOG6_106259
Panther 1 1.100 - - LDO PTHR21162
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5058
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.