DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdrg1 and Pdrg1

DIOPT Version :9

Sequence 1:NP_610538.1 Gene:Pdrg1 / 36034 FlyBaseID:FBgn0033467 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001014762.1 Gene:Pdrg1 / 296278 RGDID:1305096 Length:133 Species:Rattus norvegicus


Alignment Length:133 Identity:40/133 - (30%)
Similarity:77/133 - (57%) Gaps:6/133 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSQTDLNKSIEIITKTEELADKILVNKQELTVMDKRRQETRQAMRLMEK----SEDKKVWITIGS 61
            |...:.::.:..:.:.||||:.:|.:|:::..:|.:|.:.|:.:|.::|    |||  |.:..|:
  Rat     1 MVSPEADRVLRYLVEVEELAEAVLSDKRQIVDLDTKRNQNREGLRALQKDPSVSED--VMVCFGN 63

  Fly    62 MLVKMEREKALELLKKDQQKIEQQINLIYSDQKVLVNKHRDLEFKSPFSGTHLKPLEKKEFDALK 126
            |.:||...|..|:::|||:.::::|..:.|..||.||:..:.:.|....|.:|.||.:.|..||:
  Rat    64 MFIKMPHLKTKEMIQKDQEHLDKEIERLRSQLKVKVNRLLEAQGKPELKGFNLNPLNQDELKALQ 128

  Fly   127 ANL 129
            ..|
  Rat   129 VIL 131



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341504
Domainoid 1 1.000 75 1.000 Domainoid score I8816
eggNOG 1 0.900 - - E1_2DYP6
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5170
OMA 1 1.010 - - QHG49108
OrthoDB 1 1.010 - - D1630799at2759
OrthoFinder 1 1.000 - - FOG0009723
OrthoInspector 1 1.000 - - oto98766
orthoMCL 1 0.900 - - OOG6_106259
Panther 1 1.100 - - LDO PTHR21162
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.770

Return to query results.
Submit another query.