DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pal1 and NHLRC3

DIOPT Version :9

Sequence 1:NP_001137630.2 Gene:Pal1 / 36033 FlyBaseID:FBgn0283510 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_001012772.1 Gene:NHLRC3 / 387921 HGNCID:33751 Length:347 Species:Homo sapiens


Alignment Length:446 Identity:92/446 - (20%)
Similarity:152/446 - (34%) Gaps:154/446 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CLGSKSLAICCLLLHLLLCIRPAV-----SQTQSPQRYLHNVDSNSNNNERLHQILKGSGAGSGA 68
            |:......:..|:||...|..|.:     :.:...::.|:.:|                      
Human     7 CVAGAGFFLAFLVLHSRFCGSPVLRNFTFAVSWRTEKILYRLD---------------------- 49

  Fly    69 TQLNWPQPPKQ-TVPNVKTELAKLNN-TYVYQNAWPANNVKLGAVTAVSFDKAGNVVIFHRVN-- 129
              :.||:.|:. |.......:..||. .|:.|..                |....:::|....  
Human    50 --VGWPKHPEYFTGTTFCVAVDSLNGLVYIGQRG----------------DNIPKILVFTEDGYF 96

  Fly   130 -RVWGQTTFDNRNQYQEKYRGPIRESTILALEPATGKVQYDWGKNFFYMPHGLTVDP---EDNVW 190
             |.|..|. |.                                      |||:....   |.:||
Human    97 LRAWNYTV-DT--------------------------------------PHGIFAASTLYEQSVW 122

  Fly   191 LTDVAM----HQVFKFPPRGGDGKPALTLGDAFQ----PG------SGRKFCKPTSVAVLDNGDF 241
            :|||..    |.|.|:.          :.||..|    ||      :..:|..|..:.|.|.||.
Human   123 ITDVGSGFFGHTVKKYS----------SFGDLVQVLGTPGKKGTSLNPLQFDNPAELYVEDTGDI 177

  Fly   242 FV--ADGYCNARILKYSRKGELILFW--GQNTFSGISYDVAPQNFFAIPHALTLVPELQLLCAAD 302
            ::  .||..|.|::|.|:  :.::.|  |:|       ...|.. |.|||::|| .....:..||
Human   178 YIVDGDGGLNNRLIKLSQ--DFMILWLHGEN-------GTGPAK-FNIPHSVTL-DSAGRVWVAD 231

  Fly   303 RENGRVQCFLSSNGTFHSQYHNQLIGDRLFSMAYTPAAGGQLVIVNGPTAELGIHPEHYNEVHGF 367
            |.|.|:|.|....|.:...::|....:...|:.:||  .|:.:||    |:|.:..         
Human   232 RGNKRIQVFDKDTGEWLGAWNNCFTEEGPSSVRFTP--DGKYLIV----AQLNLSR--------- 281

  Fly   368 VLSMRSKQLVSKFGP----NNLQFQN---PHDVAVTADGNEIYVAELNPMRIHKFV 416
             ||:.:...|...|.    :.:|..:   ||.:.|......:||||:...::.|:|
Human   282 -LSVVAAPPVGSIGECSVISTIQLADQVLPHLLEVDRKTGAVYVAEIGAKQVQKYV 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pal1NP_001137630.2 NHL_PAL_like 97..416 CDD:271328 76/349 (22%)
NHL repeat 111..172 CDD:271328 6/63 (10%)
NHL repeat 178..220 CDD:271328 14/48 (29%)
NHL repeat 230..267 CDD:271328 12/40 (30%)
NHL repeat 283..321 CDD:271328 14/37 (38%)
NHL repeat 330..382 CDD:271328 11/51 (22%)
NHL repeat 388..415 CDD:271328 7/29 (24%)
NHLRC3NP_001012772.1 NHL 1 47..93 11/85 (13%)
NHL 66..336 CDD:302697 79/361 (22%)
NHL repeat 107..153 CDD:271320 16/55 (29%)
NHL 2 150..196 14/47 (30%)
NHL repeat 166..205 CDD:271320 12/40 (30%)
NHL 3 200..243 17/51 (33%)
NHL repeat 213..250 CDD:271320 14/37 (38%)
NHL repeat 258..295 CDD:271320 11/52 (21%)
NHL 4 294..338 11/43 (26%)
NHL repeat 308..335 CDD:271320 7/26 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7690
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.