DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pal1 and Phm

DIOPT Version :9

Sequence 1:NP_001137630.2 Gene:Pal1 / 36033 FlyBaseID:FBgn0283510 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_477225.1 Gene:Phm / 37823 FlyBaseID:FBgn0283509 Length:365 Species:Drosophila melanogaster


Alignment Length:123 Identity:29/123 - (23%)
Similarity:40/123 - (32%) Gaps:32/123 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLLCIRPAVSQTQSPQRYLHNVDSNSNNNERLHQILKGSGAGSGATQLNW--------------- 73
            |.||....|..|.:  .|:...:.|:..|...|.:|.|.|. .|.::..|               
  Fly    66 LYLCTPIKVDPTTT--YYIVGFNPNATMNTAHHMLLYGCGE-PGTSKTTWNCGEMNRASQEESAS 127

  Fly    74 PQPPKQTVPNVKTELAKLNNTYVYQNAWPANNVKLGAVTAVSFDKAGNVVIFHRVNRV 131
            |..|..            |:..||  ||..:..||.....|.|....|..|.:.|.:|
  Fly   128 PCGPHS------------NSQIVY--AWARDAQKLNLPEGVGFKVGKNSPIKYLVLQV 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pal1NP_001137630.2 NHL_PAL_like 97..416 CDD:271328 11/35 (31%)
NHL repeat 111..172 CDD:271328 6/21 (29%)
NHL repeat 178..220 CDD:271328
NHL repeat 230..267 CDD:271328
NHL repeat 283..321 CDD:271328
NHL repeat 330..382 CDD:271328
NHL repeat 388..415 CDD:271328
PhmNP_477225.1 Cu2_monooxygen 51..179 CDD:279429 29/123 (24%)
Cu2_monoox_C 201..350 CDD:281675
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455379
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002923
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10680
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.