DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pal1 and pamn-1

DIOPT Version :9

Sequence 1:NP_001137630.2 Gene:Pal1 / 36033 FlyBaseID:FBgn0283510 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_001367424.1 Gene:pamn-1 / 266833 WormBaseID:WBGene00020556 Length:663 Species:Caenorhabditis elegans


Alignment Length:327 Identity:98/327 - (29%)
Similarity:156/327 - (47%) Gaps:43/327 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 VYQNAWPANNVKLGAVTAVSFDKAGNVVIFHRVNRVWGQTTFDNRNQYQEKYRGPIRESTILALE 160
            :::|   ...||||.|..::|:....:::|.|..|||..:||||.|...:|  .||.:..||.:.
 Worm   348 IHEN---LGGVKLGQVAGLAFNNEQQLLVFQRAGRVWDASTFDNYNILLDK--KPIADPVILVIS 407

  Fly   161 PATG--KVQYDWGKNFFYMPHGLTVDPEDNVWLTDVAMHQVFKFPPRGGDGKPALTLGDAFQPGS 223
            .:..  |::...|...||:|||:.||.:..|:.|||..|.|.|:...|.:.|...|.|:...|||
 Worm   408 YSGNQTKLERKLGGGQFYLPHGIYVDKDGFVYTTDVGSHTVAKWKIEGNELKNIWTSGELLMPGS 472

  Fly   224 GR-KFCKPTSVAVLDNGDFFVADGYCNARILKYSRKGELILFWGQNTFSGISYDVAPQNFFAIPH 287
            .: .:||||.:..::: ..:|.|||||:|::.....|:.|..:      |:..:.|.|  |.:||
 Worm   473 DQHHYCKPTGITRVED-QLYVTDGYCNSRVVVLDLNGKRIRQF------GLPGEDAGQ--FNLPH 528

  Fly   288 ALTLVPELQLLCAADRENGRVQCFLSSNGTFHSQYHNQLIGDRLFSMAYTPAAGGQLV-IVNGPT 351
            .:......:|| ..|||||||| .:::.|....::.:     .:|:..|:.|:....| :|.|  
 Worm   529 DIVSDSAGRLL-VTDRENGRVQ-HMTTQGHVIEEFKS-----TMFTNIYSAASHEDYVFMVPG-- 584

  Fly   352 AELGIHPEHYNEVHG---FVLSMRSKQLVSKFGPNNL--------QFQNPHDVAVTADGNEIYVA 405
                 .|...:|..|   ||....:..:...|||...        ||..||.:.|..||..|:|.
 Worm   585 -----RPIMGHETEGIAVFVGRSGTGLIEYAFGPTTKGKREQMGPQFGQPHCLRVCPDGGHIFVG 644

  Fly   406 EL 407
            ::
 Worm   645 DI 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pal1NP_001137630.2 NHL_PAL_like 97..416 CDD:271328 98/326 (30%)
NHL repeat 111..172 CDD:271328 18/62 (29%)
NHL repeat 178..220 CDD:271328 16/41 (39%)
NHL repeat 230..267 CDD:271328 11/36 (31%)
NHL repeat 283..321 CDD:271328 14/37 (38%)
NHL repeat 330..382 CDD:271328 12/55 (22%)
NHL repeat 388..415 CDD:271328 7/20 (35%)
pamn-1NP_001367424.1 Cu2_monooxygen <61..146 CDD:395859
Cu2_monoox_C 168..289 CDD:397669
NHL_PAL_like 355..656 CDD:271328 97/317 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D224754at33208
OrthoFinder 1 1.000 - - FOG0002923
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105407
Panther 1 1.100 - - O PTHR10680
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5001
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.